Protein coding transcript 77178

• Transcript: Ll_transcript_454341
• CDS coordinates: 190-564 (+)
• Peptide sequence: MDRRSWLWRRKSSERSPGETESSGSMSSLSERFSDDQVYPAQVTPSPEVTSKVSSNEEHVMDVKTLTEKLAAAILNISAKEDLVKQHAKVAEEAVSGWEKAENEVSSLGQQLDAAKQKNSGLEDQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_454341

• Blastp: Filament-like plant protein 3 from Arabidopsis with 69.05% of identity
• Blastx: Filament-like plant protein 3 from Arabidopsis with 69.05% of identity
• Eggnog: filament-like plant protein(ENOG410YAAZ)
• Kegg: Link to kegg annotations (AT3G05270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458537.1)
• Pfam: Filament-like plant protein, long coiled-coil (PF05911.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;