Transcript | Ll_transcript_454355 |
---|---|
CDS coordinates | 546-893 (+) |
Peptide sequence | MDRRSWLWRRKSSERSPGETESSGSMSSLSERFSDDQVYPAQVTPSPEVTSKVSSNEEHVMDVKTLTEKLAAAILNISAKEDLVKQHAKVAEEAVSGIYCFRASPTQNVYHHKEM* |
ORF Type | complete |
Blastp | Filament-like plant protein 3 from Arabidopsis with 70.41% of identity |
---|---|
Blastx | Filament-like plant protein 3 from Arabidopsis with 70.41% of identity |
Eggnog | filament-like plant protein(ENOG410YAAZ) |
Kegg | Link to kegg annotations (AT3G05270) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458537.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer