| Transcript | Ll_transcript_454355 |
|---|---|
| CDS coordinates | 546-893 (+) |
| Peptide sequence | MDRRSWLWRRKSSERSPGETESSGSMSSLSERFSDDQVYPAQVTPSPEVTSKVSSNEEHVMDVKTLTEKLAAAILNISAKEDLVKQHAKVAEEAVSGIYCFRASPTQNVYHHKEM* |
| ORF Type | complete |
| Blastp | Filament-like plant protein 3 from Arabidopsis with 70.41% of identity |
|---|---|
| Blastx | Filament-like plant protein 3 from Arabidopsis with 70.41% of identity |
| Eggnog | filament-like plant protein(ENOG410YAAZ) |
| Kegg | Link to kegg annotations (AT3G05270) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019458537.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer