Protein coding transcript 77305

• Transcript: Ll_transcript_453771
• CDS coordinates: 12-560 (+)
• Peptide sequence: MEGIEHKTVNVNGINIHIAEKGEGPLILFIHGFPNLWYSWRNQITYLASLGYHCVVPDLRGFGDTDVPVTATSYTTLHVVGDLIGLLDTIAADEEKVLVVGHDWGAVIAWSLCLYRPDRVKALVNLRVAFTPRNPKTKPLDILRAVYGNDYYICRFQVSCNLPNLVFRLILSSTSYFFSSFI*
• ORF Type: complete

Annotations of Ll_transcript_453771

• Blastp: Epoxide hydrolase A from Mycobacterium tuberculosis complex with 40.62% of identity
• Blastx: Epoxide hydrolase A from Mycobacterium tuberculosis complex with 40.62% of identity
• Eggnog: Hydrolase(ENOG410XVV6)
• Kegg: Link to kegg annotations (Rv3617)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436306.1)
• Pfam: Chlorophyllase (PF07224.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;