Protein coding transcript 77401

• Transcript: Ll_transcript_453961
• CDS coordinates: 2780-3388 (+)
• Peptide sequence: MFEDKTGMTSSDIHLHLDKLDNKWTNQFNNFDHVVIGGGKWFLKTAIYLENNTVTGCHYCPGKNLTELGLEYAYRKALQQVFNFFTNSNHTATVFFRTTTPDHFENGEWFSGGYCNRTVPFKKGEIDMIDVDSTMRGIELEEFQKVSSLGSDKSVNLKLMDTTLLSLLRPDGHPGPYMQFQPFAKDKKGKVQNDCLHWCLPGP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_453961

• Blastp: Protein trichome birefringence-like 25 from Arabidopsis with 51.98% of identity
• Blastx: Protein trichome birefringence-like 25 from Arabidopsis with 63.49% of identity
• Eggnog: expressed protein(ENOG410XSGA)
• Kegg: Link to kegg annotations (AT1G01430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461743.1)
• Pfam: PMR5 N terminal Domain (PF14416.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;