Protein coding transcript 77404

• Transcript: Ll_transcript_453973
• CDS coordinates: 305-1087 (+)
• Peptide sequence: MRSDPTKISLQKHNHVCVKFSVSFLLVGLSFRLLLWDSFSFSSLIETSTPIAKEKTESSVFPFPIEVSDSVDVPGNNQSQTSQNDLATEKCDIFVGEWVPDQSGPIYTNESCHEIQHHQNCMKNGRFDLGYLYWRWRPRDCEIPKFNPKKFLLLMRNKSWAFIGDSISRNHVQSLLCMLSQVSLHVIFWVIPVIVNKAVELHLWKTAGSLELITYNAGPLPLNTNSLVSFSKQVYPPLELKDLYTLHQGESGLVNCKFSI*
• ORF Type: complete

Annotations of Ll_transcript_453973

• Blastp: Protein trichome birefringence-like 25 from Arabidopsis with 51.93% of identity
• Blastx: Protein trichome birefringence-like 25 from Arabidopsis with 66.67% of identity
• Eggnog: expressed protein(ENOG410XSGA)
• Kegg: Link to kegg annotations (AT1G01430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461742.1)
• Pfam: PMR5 N terminal Domain (PF14416.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;