Transcript | Ll_transcript_453977 |
---|---|
CDS coordinates | 305-1000 (+) |
Peptide sequence | MRSDPTKISLQKHNHVCVKFSVSFLLVGLSFRLLLWDSFSFSSLIETSTPIAKEKTESSVFPFPIEVSDSVDVPGNNQSQTSQNDLATEKCDIFVGEWVPDQSGPIYTNESCHEIQHHQNCMKNGRFDLGYLYWRWRPRDCEIPKFNPKKFLLLMRNKSWAFIGDSISRNHVQSLLCMLSQVLSITIPEKDFIKNVLLNFIRSNIAQMQSNTMDGDLLSQTMYQINHNAKK* |
ORF Type | complete |
Blastp | Protein trichome birefringence-like 25 from Arabidopsis with 51.98% of identity |
---|---|
Blastx | Protein trichome birefringence-like 25 from Arabidopsis with 66.67% of identity |
Eggnog | expressed protein(ENOG410XSGA) |
Kegg | Link to kegg annotations (AT1G01430) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461742.1) |
Pfam | PMR5 N terminal Domain (PF14416.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer