Protein coding transcript 77419

• Transcript: Ll_transcript_455391
• CDS coordinates: 3-521 (+)
• Peptide sequence: KASLVEERREKMDEEEHEVYGGEIPDVEGDHDNPDVDMSAADDDAAAVKELDEMKRRLKEMEEEAAALREMQAKVEKEIGSVQDPAAASQVNKEEADARSVFVGNGYSYYQGFIVSSGTLVLYFVGDETCVFLHSNFIVVKKVKRMRRKNMKASEKKKRKTNEKTFYKRKIE*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_455391

• Blastp: Polyadenylate-binding protein 3 from Arabidopsis with 76.53% of identity
• Blastx: Polyadenylate-binding protein 1 from Arabidopsis with 97.14% of identity
• Eggnog: Polyadenylate-binding protein(ENOG4111PFV)
• Kegg: Link to kegg annotations (AT5G10350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_006580259.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;