Protein coding transcript 77420

• Transcript: Ll_transcript_455394
• CDS coordinates: 3-419 (+)
• Peptide sequence: KASLVEERREKMDEEEHEVYGGEIPDVEGDHDNPDVDMSAADDDAAAVKELDEMKRRLKEMEEEAAALREMQAKVEKEIGSVQDPAAASQVNKEEADARSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPK
• ORF Type: internal

Annotations of Ll_transcript_455394

• Blastp: Polyadenylate-binding protein 3 from Arabidopsis with 80.3% of identity
• Blastx: Polyadenylate-binding protein 2 from Arabidopsis with 76.19% of identity
• Eggnog: Polyadenylate-binding protein(ENOG4111PFV)
• Kegg: Link to kegg annotations (AT5G10350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462161.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;