Protein coding transcript 77421

• Transcript: Ll_transcript_455397
• CDS coordinates: 3-371 (+)
• Peptide sequence: PISAETEKRLSRREENMDEEEHEVYGGEIPDVEGDHDNPDIDMSAADDDAAVKELDEMKRRLKEMEEEAAALREMQAKVEKEIGSVQDPAAAASLANKEEADTRSVFVGNVDYACTPEEVQQH
• ORF Type: internal

Annotations of Ll_transcript_455397

• Blastp: Polyadenylate-binding protein 3 from Arabidopsis with 78.18% of identity
• Blastx: Polyadenylate-binding protein 2 from Arabidopsis with 71.43% of identity
• Eggnog: Polyadenylate-binding protein(ENOG4111PFV)
• Kegg: Link to kegg annotations (AT5G10350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463812.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;