Transcript | Ll_transcript_455397 |
---|---|
CDS coordinates | 3-371 (+) |
Peptide sequence | PISAETEKRLSRREENMDEEEHEVYGGEIPDVEGDHDNPDIDMSAADDDAAVKELDEMKRRLKEMEEEAAALREMQAKVEKEIGSVQDPAAAASLANKEEADTRSVFVGNVDYACTPEEVQQH |
ORF Type | internal |
Blastp | Polyadenylate-binding protein 3 from Arabidopsis with 78.18% of identity |
---|---|
Blastx | Polyadenylate-binding protein 2 from Arabidopsis with 71.43% of identity |
Eggnog | Polyadenylate-binding protein(ENOG4111PFV) |
Kegg | Link to kegg annotations (AT5G10350) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463812.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer