Protein coding transcript 77426

• Transcript: Ll_transcript_455385
• CDS coordinates: 240-683 (+)
• Peptide sequence: MDDEEHEVYGGEIPDVEGDHDNPDVDMSAADDDAAAVKELDEMKRRLKEMEEEAAALREMQAKVEKGIGSVQDPAAAASSQANKEESDTRSVFVGNLFFTMDKVVLSKAICSLAIFIVYGFGLVLKHAIILLIGFNELWLSGLSLII*
• ORF Type: complete

Annotations of Ll_transcript_455385

• Blastp: Polyadenylate-binding protein 3 from Arabidopsis with 65.22% of identity
• Blastx: Polyadenylate-binding protein 2 from Arabidopsis with 83.2% of identity
• Eggnog: Polyadenylate-binding protein(ENOG4111PFV)
• Kegg: Link to kegg annotations (AT5G10350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020233274.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;