| Transcript | Ll_transcript_455388 |
|---|---|
| CDS coordinates | 3-323 (+) |
| Peptide sequence | KASLVEERREKMDEEEHEVYGGEIPDVEGDHDNPDVDMSAADDDAAAVKELDEMKRRLKEMEEEAAALREMQAKVEKEIGSVQDPAAASQVNKEEADARSVFVGNV* |
| ORF Type | 5prime_partial |
| Blastp | Polyadenylate-binding protein 3 from Arabidopsis with 76.77% of identity |
|---|---|
| Blastx | Polyadenylate-binding protein 2 from Arabidopsis with 84% of identity |
| Eggnog | Polyadenylate-binding protein(ENOG4111PFV) |
| Kegg | Link to kegg annotations (AT5G10350) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_004504101.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer