Protein coding transcript 7746

• Transcript: Ll_transcript_494837
• CDS coordinates: 3-614 (+)
• Peptide sequence: KHECFERKTTADQARPIHAKKSEGESTSNGVKLGSDMREVDVSSGSDFNNLHCSCEVCGSPSTTRCTRCKIVTYCSTKCLIEDWRWHKVNCTAGEVNSTPTERFNGDVGVHKNSRKEEENVHSSVVEATTNSKSPITRSKKDPTKEAQEHGTAKMGQSEDEATKYGKGFYCYNQSVMIGLSGLTLLEKDFTASRKSLNKGCSC*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_494837

• Blastp: Ubiquitin carboxyl-terminal hydrolase 17 from Arabidopsis with 38.16% of identity
• Blastx: Nuclear-pore anchor from Arabidopsis with 32.23% of identity
• Eggnog: ubiquitin carboxyl-terminal hydrolase(ENOG410XQ92)
• Kegg: Link to kegg annotations (AT5G65450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449297.1)
• Pfam: MYND finger (PF01753.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;