| Transcript | Ll_transcript_455922 |
|---|---|
| CDS coordinates | 132-479 (+) |
| Peptide sequence | MGVTKMTLVAIIMACMVIIGSHAEATVTCEQVTIWLTPCIPYAVLGGNVSSLCCQGVHSLNAAYKNGDDRRGSCQCVKDRAALIPGIDYNRVNEIGEKCGSKCPYKVYPTTDCSK* |
| ORF Type | complete |
| Blastp | Non-specific lipid-transfer protein 1 from Prunus with 37.93% of identity |
|---|---|
| Blastx | Non-specific lipid-transfer protein 1 from Prunus with 37.93% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019418995.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer