Protein coding transcript 77567

• Transcript: Ll_transcript_453539
• CDS coordinates: 213-737 (+)
• Peptide sequence: MSDDIFDGQILTEKLLKLNNSQQSIESLSRWCISHRKRAREVVETWDKLFNASQKEQRISFLYLANDILQNSRRKGSEFVNEFWKVLPAALRRVYGTRDQHGRKAVIRLVDIWEERKVFGSRSQGLKDEVMGKNPRPSSACNGKSSNAIKIVKKDAHSVRIKLAVGCLPEKILTA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_453539

• Blastp: Regulation of nuclear pre-mRNA domain-containing protein 1B from Mus with 42.25% of identity
• Blastx: Regulation of nuclear pre-mRNA domain-containing protein 1B from Mus with 42.25% of identity
• Eggnog: Regulation of nuclear pre-mRNA domain containing(ENOG410XRAP)
• Kegg: Link to kegg annotations (70470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432458.1)
• Pfam: RNA polymerase II-binding domain. (PF04818.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;