Transcript | Ll_transcript_454614 |
---|---|
CDS coordinates | 1292-1687 (+) |
Peptide sequence | MLHDVVITGNNGTIDGIGSVWWDLFGSHSLNYSRPHLVEIVASRFVVVSNLTFLNAPAYSIHPVYCSHVHIKNVSISAPPESPYTVGIVPDSSDSVCIEDCVVTMGYDAIALKSGWDEYGIAYGKPTENVHI |
ORF Type | 3prime_partial |
Blastp | Probable polygalacturonase from Vitis with 51.91% of identity |
---|---|
Blastx | Probable polygalacturonase from Vitis with 52.53% of identity |
Eggnog | Glycoside hydrolase family 28(COG5434) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419433.1) |
Pfam | Glycosyl hydrolases family 28 (PF00295.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer