Protein coding transcript 77703

• Transcript: Ll_transcript_454206
• CDS coordinates: 235-630 (+)
• Peptide sequence: MYRTVKTTDRATASSGQSDVYDNGSSGDNSDDLMFDINSPRRSDLSIKQGRPNVNQDKEFHGLWSNSSREAWLHGKPKADSVRNVLSNEKDMDPNCLSYERVSDGGSSSNLSGSSTKKLNLDLEFTLGQPL*
• ORF Type: complete

Annotations of Ll_transcript_454206

• Blastp: Probable transcription factor KAN2 from Arabidopsis with 52.31% of identity
• Blastx: Probable transcription factor KAN2 from Arabidopsis with 49.24% of identity
• Eggnog: Transcription factor(ENOG410YB3T)
• Kegg: Link to kegg annotations (AT1G32240)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420421.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;