Protein coding transcript 77737

• Transcript: Ll_transcript_453616
• CDS coordinates: 460-1035 (+)
• Peptide sequence: MCMLLASFNRKIPRDLTEASLSGAGLSIVAALSMMFLFGMELNNYLSVSTSTSVIVDKSSDGDFLRIDFNISFPSLSCEFASVDVSDVLGTNRLNITKTVRKFSIDSNLRPTGTEFHSGTVANAVKHDDEVDGDSVEGSLSLTTQNFDKYVHQFPITVVNFYAPWCSWCQRLKPSWEKADKVIKERHDPEID
• ORF Type: 3prime_partial

Annotations of Ll_transcript_453616

• Blastp: Protein disulfide-isomerase 5-4 from Arabidopsis with 78.38% of identity
• Blastx: Protein disulfide-isomerase 5-4 from Arabidopsis with 78.38% of identity
• Eggnog: Endoplasmic reticulumgolgi intermediate compartment protein(ENOG410XP7X)
• Kegg: Link to kegg annotations (AT4G27080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413484.1)
• Pfam: Endoplasmic Reticulum-Golgi Intermediate Compartment (ERGIC) (PF13850.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;