Protein coding transcript 77846

• Transcript: Ll_transcript_454793
• CDS coordinates: 275-757 (+)
• Peptide sequence: MEMQRIIEFHDRIMDKRPRKKPRLTWDMHPQPQPHPPIPPTKVLPTIYHNQEVGNGVAPNHAYPSMFFRGMTRNGSPPWRPDDKDGHYVFAVGDSLTPRYRIISKMGEGTFGQVLECFDNEKKEAVAIKVVRSISKYREAAMIEIDVLMRLARHDINGAR*
• ORF Type: complete

Annotations of Ll_transcript_454793

• Blastp: Serine/threonine-protein kinase AFC1 from Arabidopsis with 68.12% of identity
• Blastx: Serine/threonine-protein kinase AFC1 from Arabidopsis with 65.12% of identity
• Eggnog: CDC-like kinase(ENOG410XQF2)
• Kegg: Link to kegg annotations (AT3G53570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444388.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;