Transcript | Ll_transcript_454793 |
---|---|
CDS coordinates | 275-757 (+) |
Peptide sequence | MEMQRIIEFHDRIMDKRPRKKPRLTWDMHPQPQPHPPIPPTKVLPTIYHNQEVGNGVAPNHAYPSMFFRGMTRNGSPPWRPDDKDGHYVFAVGDSLTPRYRIISKMGEGTFGQVLECFDNEKKEAVAIKVVRSISKYREAAMIEIDVLMRLARHDINGAR* |
ORF Type | complete |
Blastp | Serine/threonine-protein kinase AFC1 from Arabidopsis with 68.12% of identity |
---|---|
Blastx | Serine/threonine-protein kinase AFC1 from Arabidopsis with 65.12% of identity |
Eggnog | CDC-like kinase(ENOG410XQF2) |
Kegg | Link to kegg annotations (AT3G53570) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444388.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer