Protein coding transcript 77877

• Transcript: Ll_transcript_454687
• CDS coordinates: 2-304 (+)
• Peptide sequence: SEVEEGERDKGREGMRRLAKAIERFGEVYERVEGKKLRYMVDLEKQRMQFTKDLEVQRMQMFMDTQVQLERIKRGKRSGSNEFGSVEVSPKNRLAMRGAAQ
• ORF Type: internal

Annotations of Ll_transcript_454687

• Blastp: Trihelix transcription factor ASIL2 from Arabidopsis with 47.83% of identity
• Blastx: Trihelix transcription factor ASIL2 from Arabidopsis with 47.83% of identity
• Eggnog: NA(ENOG410Z419)
• Kegg: Link to kegg annotations (AT3G14180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439610.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;