Protein coding transcript 77890

• Transcript: Ll_transcript_454843
• CDS coordinates: 1-1017 (+)
• Peptide sequence: AYRKMPFGLCNAPTTFQRCILAIFADLVEKCIEVFMDDFSVFGDSFDGCLKNLERILKRYEKTNLILNWEKCHFMVTEGIVLGHKISAKGLEVGRVKIEVIEKLPPQTNDKEFSWPCWFLPSVHQGLLQKAKPLCNLLLKESHFNIDNSCLEAFNLLKACLITAPVITTPNWKSSFELMCNASDYAVGAILGQRKEQVFHAIHYASKVLNEAQINYATTEKEFLAIVFTLKKFRSYLIGAQTIVCTDHTAIKYLLKKPDSKSLFIRWVLLLQEFDLEIRDKSGKENQVADHLSRLINENVVSKEKEIAETFPDEKLFQLQNRPWFVDFANYKASDGDY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_454843

• Blastp: Retrovirus-related Pol polyprotein from transposon 17.6 from Sophophora with 36.56% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon 17.6 from Sophophora with 36.56% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020203761.1)
• Pfam: Reverse transcriptase (RNA-dependent DNA polymerase) (PF00078.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;