Protein coding transcript 77891

• Transcript: Ll_transcript_454845
• CDS coordinates: 1-681 (+)
• Peptide sequence: AYRKMPFGLCNAPTTFQRCILAIFADLVEKCIEVFMDDFSVFGDSFDGCLKNLERILKRYEKTNLILNWEKCHFMVTEGIVLGHKISAKGLEVDRAKIEVIEKLPPQTNDKEFSWPCWFLPSVHQGLLQKAKPLCNLLLKESHFNIDNSCLEAFNLLKACLVTAPIIATPNRESPFELMCDASDYAVGAVLGQRKERVLHAINYASKVLTEAQINYATTEKELLAIV
• ORF Type: internal

Annotations of Ll_transcript_454845

• Blastp: Retrovirus-related Pol polyprotein from transposon opus from Sophophora with 37.82% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon opus from Sophophora with 37.82% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020203761.1)
• Pfam: Reverse transcriptase (RNA-dependent DNA polymerase) (PF00078.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;