Protein coding transcript 779

• Transcript: Ll_transcript_424598
• CDS coordinates: 23-307 (+)
• Peptide sequence: MHHSKEIWGKDADEFRPERWEKVTERQRSAFIPFSYGPCSCVGRNVAEMELSLIVSTVFRRYEFEPYQTVLETREGFLRKPLGFEVGMRRRKQA*
• ORF Type: complete

Annotations of Ll_transcript_424598

• Blastp: Benzoate 4-monooxygenase from Aspergillus with 65.69% of identity
• Blastx: Benzoate 4-monooxygenase from Aspergillus with 65.69% of identity
• Eggnog: Cytochrome p450(COG2124)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004488667.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;