Protein coding transcript 77917

• Transcript: Ll_transcript_454054
• CDS coordinates: 1144-1599 (+)
• Peptide sequence: MCASGSGLFKKKGFKGSFAEAGSHAKTFAVLSGVHSLVVCILTRLRGKNDVINAGVAGCCTGLALSFPGTPQALLQNCLTFGAFSLIVEGLNKPQPALAHSVFRKTSIDNNACPPLALPLQLPLPDEMKGAFSFFYESLKNRRKGTFPTSH*
• ORF Type: complete

Annotations of Ll_transcript_454054

• Blastp: Mitochondrial import inner membrane translocase subunit TIM22-2 from Arabidopsis with 70.42% of identity
• Blastx: Mitochondrial import inner membrane translocase subunit TIM22-3 from Arabidopsis with 63.57% of identity
• Eggnog: mitochondrial import inner membrane translocase, subunit(COG5596)
• Kegg: Link to kegg annotations (AT4G26670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442880.1)
• Pfam: Tim17/Tim22/Tim23/Pmp24 family (PF02466.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;