Transcript | Ll_transcript_455416 |
---|---|
CDS coordinates | 266-724 (+) |
Peptide sequence | MSGPLDRFARPCFEGSSGNEERRERKSDFENSEDDRRTRIGSLKKKAINASSKFRHSLRKKSSRKKSANRGNSVSIEDIRDVKELQAVDAFRQALMLDNLLSARHDDYHMLLRFLNARKLDIEKAKQMWANMIQWRKEYGTDTIMEVSHLIL* |
ORF Type | complete |
Blastp | Phosphatidylinositol/phosphatidylcholine transfer protein SFH8 from Arabidopsis with 77.4% of identity |
---|---|
Blastx | Phosphatidylinositol/phosphatidylcholine transfer protein SFH6 from Arabidopsis with 65.67% of identity |
Eggnog | Transfer protein(ENOG410XRSQ) |
Kegg | Link to kegg annotations (AT2G21520) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458734.1) |
Pfam | CRAL/TRIO, N-terminal domain (PF03765.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer