Protein coding transcript 77926

• Transcript: Ll_transcript_455417
• CDS coordinates: 385-843 (+)
• Peptide sequence: MSGPLDRSARPCLEGLSGNEDKKERKSDFENSEDDRKTRIGSLKKKAINASSKFRHSLRKKSSRKKSANRGNSVSIEDIRDVKELQAVDAFRQALMLDNLLSARHDDYHMLLRFLKARKFDIEKAKQMWANMIQWRKDYGTDTIMEVSHLIL*
• ORF Type: complete

Annotations of Ll_transcript_455417

• Blastp: Phosphatidylinositol/phosphatidylcholine transfer protein SFH8 from Arabidopsis with 76.71% of identity
• Blastx: Phosphatidylinositol/phosphatidylcholine transfer protein SFH8 from Arabidopsis with 76.71% of identity
• Eggnog: Transfer protein(ENOG410XRSQ)
• Kegg: Link to kegg annotations (AT2G21520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436895.1)
• Pfam: CRAL/TRIO, N-terminal domain (PF03765.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;