Protein coding transcript 77929

• Transcript: Ll_transcript_455423
• CDS coordinates: 130-474 (+)
• Peptide sequence: MWANMIQWRKEYGTDTIMEDFEFSELNDVLEYYPHGYHGVDKEGKPIYIERLGKVDPNKLMQVTTMDRYLRYHVQGFEKTFAIKFPACSIAAKRHIDSSTTILDVQGVGFKNFTK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_455423

• Blastp: Phosphatidylinositol/phosphatidylcholine transfer protein SFH6 from Arabidopsis with 78.26% of identity
• Blastx: Phosphatidylinositol/phosphatidylcholine transfer protein SFH6 from Arabidopsis with 78.46% of identity
• Eggnog: Transfer protein(ENOG410XRSQ)
• Kegg: Link to kegg annotations (AT4G39170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458735.1)
• Pfam: CRAL/TRIO domain (PF00650.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;