Transcript | Ll_transcript_455423 |
---|---|
CDS coordinates | 130-474 (+) |
Peptide sequence | MWANMIQWRKEYGTDTIMEDFEFSELNDVLEYYPHGYHGVDKEGKPIYIERLGKVDPNKLMQVTTMDRYLRYHVQGFEKTFAIKFPACSIAAKRHIDSSTTILDVQGVGFKNFTK |
ORF Type | 3prime_partial |
Blastp | Phosphatidylinositol/phosphatidylcholine transfer protein SFH6 from Arabidopsis with 78.26% of identity |
---|---|
Blastx | Phosphatidylinositol/phosphatidylcholine transfer protein SFH6 from Arabidopsis with 78.46% of identity |
Eggnog | Transfer protein(ENOG410XRSQ) |
Kegg | Link to kegg annotations (AT4G39170) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458735.1) |
Pfam | CRAL/TRIO domain (PF00650.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer