Protein coding transcript 77937

• Transcript: Ll_transcript_455430
• CDS coordinates: 2-328 (+)
• Peptide sequence: LIGPHALALKGYLVMKIKKERKSDFENSEDDRKTRIGSLKKKAINASSKFRHSLKKKGSRRKNAVNSISIEDIRDVKELQAVDAFRQALMLDNLLSARHDDSHMLLRFL
• ORF Type: internal

Annotations of Ll_transcript_455430

• Blastp: Phosphatidylinositol/phosphatidylcholine transfer protein SFH8 from Arabidopsis with 71.15% of identity
• Blastx: Phosphatidylinositol/phosphatidylcholine transfer protein SFH8 from Arabidopsis with 71.15% of identity
• Eggnog: Transfer protein(ENOG410XRSQ)
• Kegg: Link to kegg annotations (AT2G21520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458734.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;