Protein coding transcript 77942

• Transcript: Ll_transcript_455406
• CDS coordinates: 2-316 (+)
• Peptide sequence: EKEELLNAAVYRVDALEAELIGTKKVTGFHLKSYNLFQVGQKANSFLFYLVTILRIIFWVELACTLATCSVFCYLTVHGQFTCCLCPKVSCMLNCSIVLGTHNN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_455406

• Blastp: Phosphatidylinositol/phosphatidylcholine transfer protein SFH4 from Arabidopsis with 96% of identity
• Blastx: Phosphatidylinositol/phosphatidylcholine transfer protein SFH4 from Arabidopsis with 96% of identity
• Eggnog: Transfer protein(ENOG410XRSQ)
• Kegg: Link to kegg annotations (AT1G19650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458735.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;