Transcript | Ll_transcript_455293 |
---|---|
CDS coordinates | 444-1079 (+) |
Peptide sequence | MAFIKWVPYVLVVLLVLVNGSYALYTPPDSYLVACGSSRNVTFQGHTFVPDSQHSSLVSKTGNSFIASSNSSTTPFPIYDSARIFTDKASYRFEIQQEGRHWVRLYFSLIPNSGHNLASASITMVTDDFVLLSNFTFRNYNGSYMFKEYLVNVTSDTLTVTFIPSNGSVAFVNGIEVVSMPDELFVDQALALNPTTPFSGLSELAFETVIA* |
ORF Type | complete |
Blastp | Receptor-like protein kinase THESEUS 1 from Arabidopsis with 66.84% of identity |
---|---|
Blastx | Receptor-like protein kinase THESEUS 1 from Arabidopsis with 90.29% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT5G54380) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449142.1) |
Pfam | Carbohydrate-binding protein of the ER (PF12819.6) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer