Protein coding transcript 78017

• Transcript: Ll_transcript_455305
• CDS coordinates: 205-840 (+)
• Peptide sequence: MAFIKWVPYVLVVLLVLVNGSYALYTPPDSYLVACGSSRNVTFQGHTFVPDSQHSSLVSKTGNSFIASSNSSTTPFPIYDSARIFTDKASYRFEIQQEGRHWVRLYFSLIPNSGHNLASASITMVTDDFVLLSNFTFRNYNGSYMFKEYLVNVTSDTLTVTFIPSNGSVAFVNGIEVVSMPDELFVDQALALNPTTPFSGLSELAFETVIA*
• ORF Type: complete

Annotations of Ll_transcript_455305

• Blastp: Receptor-like protein kinase THESEUS 1 from Arabidopsis with 66.84% of identity
• Blastx: Receptor-like protein kinase THESEUS 1 from Arabidopsis with 90.29% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G54380)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449142.1)
• Pfam: Carbohydrate-binding protein of the ER (PF12819.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;