Transcript | Ll_transcript_454027 |
---|---|
CDS coordinates | 1404-1988 (+) |
Peptide sequence | MLIHKALMDINESPVYLLLNPSINHSQKDLPVSIFESELHVIDGIPQLIFVRSSYTIETVEAERISVDHVAHLKPSDGGSAATQLAAHLTGIHSAIKMLHSRIKVLHHYLLAMQKGDVPCENSLLRQVSSLLRRLPAIESGKFQDDFIMEYNDTLLISYLAMLTNCSSATNELVDKFNTAYERHSRRGGRTAFM* |
ORF Type | complete |
Blastp | COP9 signalosome complex subunit 6a from Arabidopsis with 82.99% of identity |
---|---|
Blastx | COP9 signalosome complex subunit 6a from Arabidopsis with 83.87% of identity |
Eggnog | Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome (By similarity)(COG1310) |
Kegg | Link to kegg annotations (AT5G56280) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019420987.1) |
Pfam | Maintenance of mitochondrial structure and function (PF13012.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer