Protein coding transcript 78041

• Transcript: Ll_transcript_455446
• CDS coordinates: 1-345 (+)
• Peptide sequence: VTLNGRQIFGQPIKVNWAYTSSQREDTSGYSFANTLLSTVILWNGNFIFFLHLDSGHFNIFVGDLSPEVTDATLFACFSVYPSCSDARVMWDQKTSRSRGFGFVSFRNQQVLNH*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_455446

• Blastp: Oligouridylate-binding protein 1 from Nicotiana with 68.18% of identity
• Blastx: Oligouridylate-binding protein 1 from Nicotiana with 54.55% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020227025.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;