Protein coding transcript 78045

• Transcript: Ll_transcript_455439
• CDS coordinates: 2119-2439 (+)
• Peptide sequence: MHLILLVDMLQCSWGSKPTPPGIASAPLPLPTAAAASTHVPGFSLAELAAYERQMALSKMGGVHALLHAQGQHALKQAAMGMGAPGVGYDARFQGVATSQHPMYYQ*
• ORF Type: complete

Annotations of Ll_transcript_455439

• Blastp: Oligouridylate-binding protein 1C from Arabidopsis with 51.92% of identity
• Blastx: Oligouridylate-binding protein 1 from Nicotiana with 65.55% of identity
• Eggnog: TIA1 cytotoxic granule-associated RNA binding(ENOG410XQ8U)
• Kegg: Link to kegg annotations (AT3G14100)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443470.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;