Transcript | Ll_transcript_468622 |
---|---|
CDS coordinates | 59-475 (+) |
Peptide sequence | MLNPSVTCAILVTLTTYMFMVPVQCEENTFPQVTTVSVKNDLGNGIILFLHCKSRDNDLGVHSLAYGQSQTWSFRLNVIGSTLFFCRVTWNNVDRSLEIYNANTDDAQCLSQCYRSVTLDGIFYYWQFKDYWYQKYKW* |
ORF Type | complete |
Blastp | S-protein homolog 24 from Arabidopsis with 34.04% of identity |
---|---|
Blastx | S-protein homolog 24 from Arabidopsis with 34.04% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_004511060.1) |
Pfam | Plant self-incompatibility protein S1 (PF05938.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer