Protein coding transcript 78111

• Transcript: Ll_transcript_455855
• CDS coordinates: 988-1287 (+)
• Peptide sequence: MSRILIEFHHLTVNSEQELGITALHIKLRATGGNKTKTPGPGAQSALRALARSGMKIGRIGICHSIVCLLNSWLILCSLVSLNGICYLLISMLFYFQRM*
• ORF Type: complete

Annotations of Ll_transcript_455855

• Blastp: 40S ribosomal protein S14 from Zea with 97.73% of identity
• Blastx: 40S ribosomal protein S14 from Lupinus with 93.1% of identity
• Eggnog: Located on the platform of the 30S subunit, it bridges several disparate RNA helices of the 16S rRNA. Forms part of the Shine-Dalgarno cleft in the 70S ribosome (By similarity)(COG0100)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433773.1)
• Pfam: Ribosomal protein S11 (PF00411.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;