Protein coding transcript 78114

• Transcript: Ll_transcript_455864
• CDS coordinates: 1-363 (+)
• Peptide sequence: RNSHPAKRFIYPSSFSHLFLTHKFYSFIFLDFRLIRMSRRKVREPKEETVTLGPAVRDGEHVFGVARIFASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAMLAAQDVATRCK
• ORF Type: internal

Annotations of Ll_transcript_455864

• Blastp: 40S ribosomal protein S14 from Lupinus with 96.47% of identity
• Blastx: 40S ribosomal protein S14 from Lupinus with 96.47% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433773.1)
• Pfam: Ribosomal protein S11 (PF00411.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;