Transcript | Ll_transcript_278003 |
---|---|
CDS coordinates | 165-674 (+) |
Peptide sequence | MAMMDGGNNNLEELAVGCMLSIRTTLGDEFEGQVVTFDRPSNILVLQEGFKHGPRRNIRLLKTNYIKDFTFLGQSDDPLDPNNCFLDLTALQTREELAIRQAEADAERIGVGVTTEAQSIFDALSKTLPVRWDKTVIVVMNEVRVGSPYNSESVIGGTPAANDRVKKMV* |
ORF Type | complete |
Blastp | Protein LSM12 homolog from Xenopus with 31.71% of identity |
---|---|
Blastx | Protein LSM12 homolog from Xenopus with 31.71% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (444151) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415760.1) |
Pfam | Anticodon-binding domain (PF09793.8) |
Rfam | - |
GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer