Protein coding transcript 782

• Transcript: Ll_transcript_468630
• CDS coordinates: 2-364 (+)
• Peptide sequence: FCHFRDNMAPKYEMALGLNKGHRTTKIPVGKSKADKKHKIKPSRLKGLQTKHSKFVRDLIREVCGHAPYEKRGMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNILTQMRKAHAQK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_468630

• Blastp: 60S ribosomal protein L36 from Sophophora with 75% of identity
• Blastx: 60S ribosomal protein L36 from Sophophora with 75% of identity
• Eggnog: 60S ribosomal protein l36(COG5051)
• Kegg: Link to kegg annotations (Dmel_CG7622)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013452367.1)
• Pfam: Ribosomal protein L36e (PF01158.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;