Protein coding transcript 78257

• Transcript: Ll_transcript_342180
• CDS coordinates: 1134-1769 (+)
• Peptide sequence: MLKFMQELRKVVTIGVVGGSDFVKISEQLGNTVTNDYDYVFSENGLLAHKEGKLIGIQSLKDFIGEEKLKEIINFTLHYIADLDIPIKRGTFIEFRSGMLNVSPIGRNCSQEERDEFEKYDKVQNIRSKMVSVLREKFAHLNLTFSIGGQISFDVFPQGWDKTYCLKYLDDFTEIHFFGDKTYKVVHSLLCKDFKPTMFAIIYSLPLAYIC*
• ORF Type: complete

Annotations of Ll_transcript_342180

• Blastp: Phosphomannomutase from Oryza sativa with 85.33% of identity
• Blastx: Phosphomannomutase from Oryza sativa with 85.79% of identity
• Eggnog: ,hydrolase(COG0561)
• Kegg: Link to kegg annotations (4337437)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426453.1)
• Pfam: Eukaryotic phosphomannomutase (PF03332.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;