Protein coding transcript 78262

• Transcript: Ll_transcript_342128
• CDS coordinates: 1134-1793 (+)
• Peptide sequence: MLKFMQELRKVVTIGVVGGSDFVKISEQLGNTVTNDYDYVFSENGLLAHKEGKLIGIQSLKDFIGEEKLKEIINFTLHYIADLDIPIKRGTFIEFRSGMLNVSPIGRNCSQEERDEFEKYDKVQNIRSKMVSVLREKFAHLNLTFSIGGQISFDVFPQGWDKTYCLKYLDDFTEIHFFGDKTYKGGNDHEIYESERTIGHTVTSPEDTIKQCKALFLGN*
• ORF Type: complete

Annotations of Ll_transcript_342128

• Blastp: Phosphomannomutase from Soja with 90.87% of identity
• Blastx: Phosphomannomutase from Soja with 91.11% of identity
• Eggnog: ,hydrolase(COG0561)
• Kegg: Link to kegg annotations (732605)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426420.1)
• Pfam: Eukaryotic phosphomannomutase (PF03332.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;