Protein coding transcript 78286

• Transcript: Ll_transcript_342186
• CDS coordinates: 503-964 (+)
• Peptide sequence: MDLATLNSTLDKLIIKVVPMENLNGRKLVEAGDLCERRNGRGVDLNRNWSVDWGKKEKDYDPYEENPGFAPFSEPETQIMQKLAMSFDPHIWVNVHSGMEALFMPYDHKNTTPDELPLQRMKSLLEEVNLLHCQKHCMIGSGGGSVGSVYIII*
• ORF Type: complete

Annotations of Ll_transcript_342186

• Blastp: Metallocarboxypeptidase A-like protein TRV_02598 from Trichophyton with 28.26% of identity
• Blastx: Metallocarboxypeptidase A-like protein TRV_02598 from Trichophyton with 27.75% of identity
• Eggnog: metallocarboxypeptidase activity(COG2866)
• Kegg: Link to kegg annotations (TRV_02598)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020234667.1)
• Pfam: Zinc carboxypeptidase (PF00246.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;