Protein coding transcript 78310

• Transcript: Ll_transcript_342674
• CDS coordinates: 306-644 (+)
• Peptide sequence: MRLLSLVDLSSDGSAQIPYELIKDTLQITDDEVELWVVKAITAKLIVGKIDQMNQVVIVSHHTDRVFSQHQWQTLRTKLVTWRGNIANVISTIQANKIPEDGSQAAQGLVVR*
• ORF Type: complete

Annotations of Ll_transcript_342674

• Blastp: Eukaryotic translation initiation factor 3 subunit M from Parastagonospora with 38.38% of identity
• Blastx: Eukaryotic translation initiation factor 3 subunit M from Dictyostelium with 41.4% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SNOG_03517)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442748.1)
• Pfam: PCI domain (PF01399.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;