Protein coding transcript 78377

• Transcript: Ll_transcript_342444
• CDS coordinates: 300-788 (+)
• Peptide sequence: MFERSGYTLLSLVSNVLLLLIVILFLWAKSAAILNRPAPPLPKLHLSEETVNEVAAFIRTRVNDLLSASQDVALGKDSRLFLKVAAYLCLISIVGGLTDFLTLAYTSLFIVLTFPALYERYEDSIDRNILKGCRKLCQLYVKINVEYVSRVQNWIVEKEKLC*
• ORF Type: complete

Annotations of Ll_transcript_342444

• Blastp: Reticulon-like protein B11 from Arabidopsis with 47.29% of identity
• Blastx: Reticulon-like protein B12 from Arabidopsis with 52.49% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT3G19460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432008.1)
• Pfam: Reticulon (PF02453.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;