Protein coding transcript 78422

• Transcript: Ll_transcript_341329
• CDS coordinates: 2-769 (+)
• Peptide sequence: DFYNWNRIKVRYCDGASFTGDVEAVNPVTKLHFRGARVFTAVIEDLLAKGMKNAGNAIISGCSAGGLTSILHCDRFRALLPTRANVKCISDAGYFINARDVSGTRHIEQFFSQIVATHGSARNLPPSCTSRLSPGLCFFPQYFVSQIATPIFLINAAYDSWQIKNILAPGVADPRGHWHSCKLDINNCSSNQLDTMQGFRTEFLRALTVLGNSQSKGMFIDSCYAHCQTEMQETWFRSDSPLLAKTVRDCIIYIF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_341329

• Blastp: Pectin acetylesterase 8 from Arabidopsis with 68.29% of identity
• Blastx: Pectin acetylesterase 8 from Arabidopsis with 64.71% of identity
• Eggnog: pectinacetylesterase(ENOG410XQKD)
• Kegg: Link to kegg annotations (AT4G19420)
• CantataDB: Link to cantataDB annotations (CNT0000075)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422153.1)
• Pfam: Pectinacetylesterase (PF03283.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;