Transcript | Ll_transcript_341944 |
---|---|
CDS coordinates | 190-687 (+) |
Peptide sequence | MEMVPENMKRQLSLAVRSIQWIYAIFWSGSDTNPRVLIWREGYYNGDIKTRKTNQGLELNSDQIGLQRSEQLRELFRSLKTTEATKKPSATLPPEDLTDTEWYYLVCMSFVFNIGQGLPGRTLANDRPIWLCNAHSTDCILFSRSLLAKVGFCFLIWLVLTSGLD* |
ORF Type | complete |
Blastp | Transcription factor EGL1 from Arabidopsis with 61.29% of identity |
---|---|
Blastx | Transcription factor EGL1 from Arabidopsis with 61.29% of identity |
Eggnog | Transcription factor(ENOG410Z2WK) |
Kegg | Link to kegg annotations (AT1G63650) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019422570.1) |
Pfam | bHLH-MYC and R2R3-MYB transcription factors N-terminal (PF14215.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer