Protein coding transcript 785

• Transcript: Ll_transcript_468646
• CDS coordinates: 1-315 (+)
• Peptide sequence: TVQTAVSGGSGIIAGGANVLPKLCVKIWNLCTEGKYEEAIELQKVLSKCDWVLTKSAIAGTKAAIELEYGYGGFPRKPLQRLSEEERQKIKKGIAEAMEIENKL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_468646

• Blastp: -
• Blastx: L-threo-3-deoxy-hexylosonate aldolase from Trichoderma with 64.42% of identity
• Eggnog: Catalyzes the condensation of (S)-aspartate-beta- semialdehyde (S)-ASA and pyruvate to 4-hydroxy- tetrahydrodipicolinate (HTPA) (By similarity)(COG0329)
• Kegg: Link to kegg annotations (ABP04235)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017436423.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;