Protein coding transcript 78571

• Transcript: Ll_transcript_341197
• CDS coordinates: 3-659 (+)
• Peptide sequence: WGFFQVVNHGVSHELMKSAKELWREFFNQPLEEKEAYANSPSTYEGYGSRLGVKKGAILDWSDYFFLHYMPLSLRNQAKWPSIPQSLRKVIGEYSEEVIKLGGRILKIMSKNLGLKEDDLIKAFGGENEVGGCLRVNFYPKCPQPDLTLGLSSHSDPGGMTIILPDDFVSGLQVYRGNEWVTVKPVPNAFIINIGDQIQVMSNAIYKSVEHRVIVNSNE
• ORF Type: internal

Annotations of Ll_transcript_341197

• Blastp: Probable 2-oxoglutarate-dependent dioxygenase At5g05600 from Arabidopsis with 68.04% of identity
• Blastx: Probable 2-oxoglutarate-dependent dioxygenase At5g05600 from Arabidopsis with 68.04% of identity
• Eggnog: 2OGFe(II) oxygenase(COG3491)
• Kegg: Link to kegg annotations (AT5G05600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413119.1)
• Pfam: non-haem dioxygenase in morphine synthesis N-terminal (PF14226.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;