Protein coding transcript 78578

• Transcript: Ll_transcript_341209
• CDS coordinates: 962-1645 (+)
• Peptide sequence: MRIGSMSSPKLPSLVDLCVQKVIDNIRYLGNVGSVELYLLERILPHCTLDQLMHVEKASEGSDLSPVTDKLWKRFFEKQFGTNCTNEVIRRMQAKRVSFKWMQLYEAKLKEVAEAENEAVDRIKQRYKKEDAKKQSRQVRLCTKVPPSSKKRFWGDSGPGYNVSNVKSNIMKKAKIEFLKSPEVKNLAAMKRNSIQRNVSSSSIMKTGSISGIASTSKNPKSTKRII*
• ORF Type: complete

Annotations of Ll_transcript_341209

• Blastp: Elongin-A from Schizosaccharomyces with 25.91% of identity
• Blastx: -
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440699.1)
• Pfam: RNA polymerase II transcription factor SIII (Elongin) subunit A (PF06881.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;