Protein coding transcript 787

• Transcript: Ll_transcript_321636
• CDS coordinates: 39-332 (+)
• Peptide sequence: MALQPRVISCGKRVAASAMAVKFLIGPGVMAAASFAVGLRGVILQIAIVQAALPLGIVPFVFAKEYNVHPEILSTSVIFGMVVALPVTLIFYILLGL*
• ORF Type: complete

Annotations of Ll_transcript_321636

• Blastp: Probable auxin efflux carrier component 1b from Oryza sativa with 79.82% of identity
• Blastx: Probable auxin efflux carrier component 1b from Oryza sativa with 79.82% of identity
• Eggnog: Auxin Efflux Carrier(ENOG410YBI4)
• Kegg: Link to kegg annotations (4349716)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457725.1)
• Pfam: Membrane transport protein (PF03547.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;