Protein coding transcript 78715

• Transcript: Ll_transcript_343467
• CDS coordinates: 61-693 (+)
• Peptide sequence: MEKGENSSTTEQDSSDNHKHPTRHHLTLPSGLTPDEFETLKPAITEHHTYLSGPGQCSTLLAQRIHAPPQTVWSAVRRFDKPHLYKHFIKSCSVKEPFNMSVGCTREVNVISGLPAATSTERLDILDDDRHVTGFSIIGGEHRLRNYRSVTSVHGFDRDGEIWTVVLESYMVDVPEGNTEEDTRLFADTVVKLNLQKLASLTEGMNRHGA*
• ORF Type: complete

Annotations of Ll_transcript_343467

• Blastp: Abscisic acid receptor PYR1 from Arabidopsis with 71.04% of identity
• Blastx: Abscisic acid receptor PYR1 from Arabidopsis with 71.04% of identity
• Eggnog: abscisic acid receptor(ENOG410YDHK)
• Kegg: Link to kegg annotations (AT4G17870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420169.1)
• Pfam: Polyketide cyclase / dehydrase and lipid transport (PF10604.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;